PTM Viewer PTM Viewer

AT5G22920.1

Arabidopsis thaliana [ath]

CHY-type/CTCHY-type/RING-type Zinc finger protein

No PTMs currently found

PLAZA: AT5G22920
Gene Family: HOM05D000548
Other Names: AtRZPF34,CHYR1,CHY zinc-finger and RING protein 1,RZPF34,RING zinc-finger protein 34

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 291

MDMGFHENEQNQEFANLMEIGSGHYGCSHYRRRCKIRAPCCDEIFDCRHCHNEAKDSLHIEQHHRHELPRHEVSKVICSLCETEQDVQQNCSNCGVCMGKYFCSKCKFFDDDLSKKQYHCDECGICRTGGEENFFHCKRCRCCYSKIMEDKHQCVEGAMHHNCPVCFEYLFDSTRDITVLRCGHTMHLECTKDMGLHNRYTCPVCSKSICDMSNLWKKLDEEVAAYPMPKMYENKMVWILCNDCGSNTNVRFHLIAHKCSSCGSYNTRQTQRGSDSHSCSSGMPQVVGSTG

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR001841 162 207
IPR008913 20 101
IPR017921 98 162
Sites
Show Type Position
Active Site 27
Active Site 29
Active Site 47
Active Site 50
Active Site 40
Active Site 41
Active Site 51
Active Site 66
Active Site 78
Active Site 81
Active Site 91
Active Site 94
Active Site 103
Active Site 106
Active Site 119
Active Site 126
Active Site 120
Active Site 123
Active Site 136
Active Site 143
Active Site 137
Active Site 140
Active Site 152
Active Site 154

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here